General Information

  • ID:  hor004719
  • Uniprot ID:  Q9MA62
  • Protein name:  Protein RALF-like 22
  • Gene name:  RALFL22
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  Plant rapid alkalinization factor (RALF) family
  • Source:  Plant
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007267 cell-cell signaling; GO:0019722 calcium-mediated signaling
  • GO CC:  GO:0005576 extracellular region; GO:0009506 plasmodesma; GO:0048046 apoplast

Sequence Information

  • Sequence:  AQKKYISYGAMRRNSVPCSRRGASYYNCQRGAQANPYSRGCSTITRCRR
  • Length:  49
  • Propeptide:  MTNTRAIYAVIAILAIVISAVESTGDFGDSLDFVRAGSSSLFSGCTGSIAECIAEEEEMEFDSDISRRILAQKKYISYGAMRRNSVPCSRRGASYYNCQRGAQANPYSRGCSTITRCRR
  • Signal peptide:  MTNTRAIYAVIAILAIVISAVES
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cell signaling peptide that may regulate plant stress, growth, and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2+) concentration leading to a calcium-dependent signaling events through a cell surface receptor and a concomitant activation of some intracellular mitogen-activated protein kinases.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  18-28; 41-47
  • Structure ID:  AF-Q9MA62-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004719_AF2.pdbhor004719_ESM.pdb

Physical Information

Mass: 645066 Formula: C231H376N84O69S5
Absent amino acids: DEFHLW Common amino acids: R
pI: 11.03 Basic residues: 11
Polar residues: 24 Hydrophobic residues: 8
Hydrophobicity: -107.55 Boman Index: -17400
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 32.04
Instability Index: 4358.98 Extinction Coefficient cystines: 7700
Absorbance 280nm: 160.42

Literature

  • PubMed ID:  12611624
  • Title:  Peptomics, Identification of Novel Cationic Arabidopsis Peptides with Conserved Sequence Motifs.